PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00000699.1.g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 395aa    MW: 44302.5 Da    PI: 7.2781
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00000699.1.g00007.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.9e-33257312156
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                     k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  FANhyb_rscf00000699.1.g00007.1 257 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 312
                                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-30254315IPR009057Homeodomain-like
PROSITE profilePS5129414.318254314IPR017930Myb domain
SuperFamilySSF466892.19E-18254315IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-27257312IPR006447Myb domain, plants
PfamPF002496.1E-8259310IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGSVPPELSL DFRPSFVPKT ITDFLKEVSL IGNVTERLSK LDDFVKRLEE EMRKIDAFKR  60
ELPLCMFLLN DAIQALKEDA MQCAKPNVQP VLEEFIPLKK DCDKKTGEPN NHKKEKDSRD  120
KKNWMSSVQL WNTDNYHHPT SDFPCDRKQG SEIDSKRNEA RNGVANEDPF QTCRDRNGGR  180
AFVPFKAYPA FSVTAVKEDK EDLAVHGLSL LTPGIKNPKE ESASSGSRST CGRAVSFSAA  240
NVQSNMRISP QQPTSRKQRR CWSPELHRRF VNALQQLGGS QVATPKQIRE LMQVDGLTND  300
EVKSHLQKYR LHTRRVPAAK SAPANQSVVV LGDLWTSPDQ YDHSKANSSQ SGSPQGPLQL  360
AENGGDDEED SDDDDAKSES YSWKGHIHKP GKDDV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011458328.10.0PREDICTED: uncharacterized protein LOC101303079
TrEMBLM5VM720.0M5VM72_PRUPE; Uncharacterized protein
STRINGVIT_03s0063g01060.t011e-173(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-58G2-like family protein